] LITHIUM.AjaxSupport.useTickets = false; "initiatorBinding" : true, "action" : "rerender" "action" : "rerender" ","loaderSelector":"#lineardisplaymessageviewwrapper .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); ] $('li.close-on-click').on('click',resetMenu); LITHIUM.Dialog.options['424451256'] = {"contentContext":"valuesurveys.widget.survey-prompt-dialog","dialogOptions":{"minHeight":399,"draggable":false,"maxHeight":800,"resizable":false,"autoOpen":false,"width":610,"minWidth":610,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modal-simple lia-panel-dialog-modal-valuesurvey","position":["center","center"],"modal":true,"maxWidth":610,"ariaLabel":"Feedback for community"},"contentType":"ajax"}; } "event" : "addThreadUserEmailSubscription", "action" : "pulsate" "context" : "envParam:feedbackData", Dann logg Dich bitte hier in Deinem Kundencenter ein. "kudosLinksDisabled" : "false", "closeImageIconURL" : "https://forum.vodafone.de/skins/images/3633B7E3512025038504892977369C15/responsive_peak/images/button_dialog_close.svg", "action" : "rerender" "action" : "rerender" .attr('aria-selected','false'); $(this).removeClass('active'); "disableLinks" : "false", "selector" : "#kudosButtonV2_0", }); } "context" : "lia-deleted-state", logmein: [76, 79, 71, 77, 69, 73, 78], } { { "actions" : [ "parameters" : { ] "context" : "envParam:quiltName", LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "accessibility" : false, { }, "event" : "expandMessage", ] "actions" : [ "context" : "", ] }, "parameters" : { { { { "event" : "editProductMessage", Die Rufnummernmitnahme von einem anderen Anbieter zu Callya Digital ist möglich, allerdings nicht mit allen Geräten. } //if(height > 430) { })(LITHIUM.jQuery); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { { }); "initiatorBinding" : true, Bei CallYa Digital müssen die Bankdaten zwingend angegeben werden. "event" : "MessagesWidgetEditAnswerForm", { "actions" : [ })(LITHIUM.jQuery); // Pull in global jQuery reference }, "componentId" : "kudos.widget.button", { .attr('aria-expanded','false'); { } //} else { }); Ruf bitte an unter 0172 229 0 229. "quiltName" : "ForumMessage", ] "truncateBodyRetainsHtml" : "false", Oder ruf mit Deiner CallYa-Nummer die kostenlose Service-Nummer 12 007 an und folge der Ansage. { { "event" : "QuickReply", "context" : "", ] }, "actions" : [ LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper","componentSelector":"#lineardisplaymessageviewwrapper","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2045377,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "selector" : "#messageview_1", $(this).next().toggle(); $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "componentId" : "kudos.widget.button", ] "event" : "MessagesWidgetEditAnswerForm", ], $('#custom-overall-notif-count').html(notifCount); "action" : "rerender" "actions" : [ "}); "action" : "addClassName" "actions" : [ "useTruncatedSubject" : "true", "actions" : [ ] var neededkeys = [76, 79, 71, 77, 69, 73, 78]; "disableLinks" : "false", "context" : "", "displaySubject" : "true", ] "}); ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } } ] ] { $(document).ready(function(){ }, // Oops. ;(function($) { } else { var key = e.keyCode; "context" : "envParam:entity", } var ctaHTML = ''; { "initiatorDataMatcher" : "data-lia-message-uid" } } "actions" : [ watching = false; { LITHIUM.AjaxSupport.fromLink('#enableAutoComplete_17c8127e6d520e', 'enableAutoComplete', '#ajaxfeedback_17c8127e6d520e_0', 'LITHIUM:ajaxError', {}, 'GIjFhFO80xY6Qm51qM6Xt1txRD5FyPmhU-Je_q7iUkc. if ( count == neededkeys.length ) { "action" : "rerender" // If watching, pay attention to key presses, looking for right sequence. }); // enable redirect to login page when "logmein" is typed into the void =) ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_17c8127e6d520e","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/CallYa/thread-id/83969&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); }, { "kudosable" : "true", "actions" : [ }); }else{ }; "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/CallYa/thread-id/83969","ajaxErrorEventName":"LITHIUM:ajaxError","token":"bxZAQuXgEm1RMvyOWerbk8gy9gNU0IPv_4vUxMdqhuE. "truncateBodyRetainsHtml" : "false", watching = false; { { { } Du bekommst dazu eine SMS von uns. }, $('#node-menu li.active').children('ul').show(); if($('body.lia-window-scroll #vodafone-community-header .lia-search-input-wrapper').css('opacity') > 0) { }); "event" : "removeMessageUserEmailSubscription", { "actions" : [ { { "buttonDialogCloseAlt" : "Schließen", { { } }, } "event" : "MessagesWidgetMessageEdit", "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_11","feedbackSelector":".InfoMessage"}); "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_7","feedbackSelector":".InfoMessage"}); $('.menu-container').on('click','.community-node-menu-btn.active', {'selector' : '.css-node-menu' }, handleClose); "event" : "ProductAnswerComment", { resetMenu(); LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "editProductMessage", "action" : "rerender" if ( watching ) { "}); } if ( watching ) { Eine längerfristige Vertragsbindung gibt es dabei nicht. "action" : "rerender" "context" : "", "event" : "addMessageUserEmailSubscription", Bist du sicher, dass du fortfahren möchtest? } "actions" : [ "useSimpleView" : "false", "displayStyle" : "horizontal", ] "event" : "removeMessageUserEmailSubscription", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2046171,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. ] { "event" : "ProductAnswerComment", }); { "action" : "rerender" } //$('#vodafone-community-header, #vodafone-community-header .lia-search-input-wrapper').css('display','none'); "action" : "rerender" { if ( neededkeys[count] == key ) { "action" : "rerender" "context" : "envParam:quiltName", "event" : "MessagesWidgetEditAction", LITHIUM.Dialog({ // Oops. LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; "action" : "rerender" "selector" : "#messageview_1", $(document).keydown(function(e) { "context" : "", element.siblings('li').find('li').removeClass('active'); // We're good so far. { notifCount = parseInt($(this).html()) + notifCount; "action" : "rerender" "actions" : [ "truncateBodyRetainsHtml" : "false", }, "includeRepliesModerationState" : "false", $('#vodafone-community-header .lia-search-input-wrapper').fadeToggle() } }, // Oops, not the right sequence, lets restart from the top. watching = true; var count = 0; "context" : "envParam:quiltName", "useTruncatedSubject" : "true", { "quiltName" : "ForumMessage", "actions" : [ ] "context" : "", ] ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); } ] "action" : "rerender" "actions" : [ "context" : "", "initiatorBinding" : true, { "dialogContentCssClass" : "lia-panel-dialog-content", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { } Bist du sicher, dass du fortfahren möchtest? } }); "linkDisabled" : "false" ] ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { ] { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2045416 .lia-rating-control-passive', '#form_0'); }, { Was es bislang bei den CallYa-Tarifen nicht gibt, ist die 5G-Anbindung. "context" : "envParam:quiltName", }, })(LITHIUM.jQuery); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); { }); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } ] }); LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); { { LITHIUM.AjaxSupport.ComponentEvents.set({ { "event" : "RevokeSolutionAction", "action" : "rerender" ] "revokeMode" : "true", "context" : "envParam:quiltName,message", "forceSearchRequestParameterForBlurbBuilder" : "false", ] if ( watching ) { { Bestelle Dir jetzt DSL-Internet, Telefon und TV und sichere Dir neben Geschwindigkeiten von bis zu 250 Mbit/s VDSL Top-Entertainment mit Apple TV 4K. LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); } }, ] }, "actions" : [ { "disableKudosForAnonUser" : "false", $(this).next().toggle(); ] if(do_scroll == "true"){ "event" : "deleteMessage", }); "}); ] Du hast eine reguläre, ordentliche Kündigung verschickt. "event" : "MessagesWidgetCommentForm", "action" : "rerender" Dann hast Du nun 4 Wochen Zeit, der Kündigung zu widersprechen. } var position_x = msg.offset(); "componentId" : "kudos.widget.button", }, Um diese zu nutzen, können Sie einfach nach Vertragsende Guthaben auf Ihre Karte laden und Sie werden automatisch den Prepaid-Tarif CallYa Talk&SMS nutzen. "actions" : [ if ( key == neededkeys[0] ) { }); } "actions" : [ { "actions" : [ $('#vodafone-community-header .lia-search-input-wrapper').hide(); "context" : "", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { }, ] LITHIUM.Auth.CHECK_SESSION_TOKEN = 'KCSVL3fQV3ut8sMi9S0IRWc0WxX6dvjHo-Z3zn-N2OI. } "actions" : [ }); "useTruncatedSubject" : "true", LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); ] "closeImageIconURL" : "https://forum.vodafone.de/skins/images/3633B7E3512025038504892977369C15/responsive_peak/images/button_dialog_close.svg", "event" : "MessagesWidgetCommentForm", "context" : "envParam:quiltName,message,product,contextId,contextUrl", ] notifCount = parseInt($(this).html()) + notifCount; ', 'ajax'); // We made it! "event" : "AcceptSolutionAction", LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; ] }); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.AjaxSupport.fromForm('#form_1', 'GiveRating', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); ] ] }, ] "context" : "envParam:selectedMessage", "context" : "envParam:quiltName", "event" : "editProductMessage", }); "event" : "QuickReply", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "accessibility" : false, } "context" : "", "context" : "", // Set start to true only if the first key in the sequence is pressed "entity" : "2045416", ', 'ajax'); "action" : "rerender" "action" : "rerender" "event" : "MessagesWidgetCommentForm", "revokeMode" : "true", element.siblings('li').children('ul').slideUp(); Betreff: EIN JAHR SPÄTER verbraucht die LTE-Einwah... Betreff: Callya Karte für Standheizung wurde deakt... Callya Karte für Standheizung wurde deaktiviert. Auch wenn der Name CallYa Digital an eine Prepaid-Lösung erinnert, so ist es vielmehr ein Laufzeitvertrag mit monatlicher Kündigung. }); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] "actions" : [ ] "ajaxEvent" : "LITHIUM:lightboxRenderComponent", createStorage("false"); { { "useSubjectIcons" : "true", "action" : "rerender" }, "context" : "", "event" : "kudoEntity", "event" : "MessagesWidgetAnswerForm", "action" : "rerender" { ] "event" : "MessagesWidgetEditAction", } "dialogKey" : "dialogKey" "event" : "RevokeSolutionAction", { $(document).keydown(function(e) { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); //}); "displaySubject" : "true", "context" : "envParam:quiltName,message", { "context" : "", { LITHIUM.StarRating('#any_0', true, 2, 'LITHIUM:starRating'); } ] }, }); if ( neededkeys[count] == key ) { "useCountToKudo" : "false", } "context" : "", }, var handleClose = function(event) { "actions" : [ "context" : "envParam:entity", //} else { // Set start to true only if the first key in the sequence is pressed ] "event" : "unapproveMessage", } "initiatorBinding" : true, { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"});
Institut Christus König Kritik, Excel Tutorial Deutsch, Flug München Florenz, Berghütte Kinder Allgäu, Gelsebach Bad Nauheim, Kallax Türen Selber Bauen, Ks Tools Werkzeugkiste Gefüllt, Beliebteste Vornamen 2019, Open Air Kino Baden-baden, Kulturpalast Warschau Abriss, Urologie Barmherzige Brüder Salzburg, Coffee Circle Probierpaket, Akutgeriatrie Barmherzige Brüder,
JAN
2021

About the Author: